{ "context" : "", "actions" : [ }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); } "initiatorBinding" : true, "event" : "removeMessageUserEmailSubscription", "useSimpleView" : "false", "action" : "rerender" "selector" : "#messageview_9", "selector" : "#kudosButtonV2_9", { "linkDisabled" : "false" "actions" : [ LITHIUM.Dialog.options['1277240598'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" "disableKudosForAnonUser" : "false", }, "action" : "rerender" { { "event" : "MessagesWidgetAnswerForm", ] "actions" : [ } } "action" : "rerender" "action" : "rerender" "useSimpleView" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetEditAnswerForm", { ] { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_7df3a644f597c', 'disableAutoComplete', '#ajaxfeedback_7df3a638a041b_0', 'LITHIUM:ajaxError', {}, 'RMCYojgcbQOlUdOeEukXJYJb_iSy3GHPo2vKtA8lyg4. "action" : "rerender" ] "truncateBodyRetainsHtml" : "false", "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" { }, "entity" : "1950592", "componentId" : "kudos.widget.button", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" }, ] } }); "context" : "", ] "event" : "RevokeSolutionAction", { LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "deleteMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); { ] "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName,expandedQuiltName", "kudosLinksDisabled" : "false", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" Execute whatever should happen when entering the right sequence } "event" : "AcceptSolutionAction", "action" : "rerender" "event" : "deleteMessage", ', 'ajax'); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_7df3a638a041b_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/256654&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, { { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "initiatorDataMatcher" : "data-lia-kudos-id" { "useTruncatedSubject" : "true", "disableLabelLinks" : "false", { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { $(this).next().toggle(); { "action" : "addClassName" "actions" : [ { "selector" : "#kudosButtonV2_7", }, }); "event" : "expandMessage", } "event" : "ProductMessageEdit", "event" : "expandMessage", "actions" : [ Nach ein wenig Recherche im Internet bestätigte sich die sehr schlechte Qualität dieser Box. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1950444,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", { if ( Number(val) < 1 ) "action" : "rerender" } LITHIUM.Dialog.options['773659222'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditAnswerForm", "event" : "QuickReply", } } "context" : "", "event" : "approveMessage", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); { ], "event" : "RevokeSolutionAction", } "context" : "envParam:entity", Execute whatever should happen when entering the right sequence LITHIUM.AjaxSupport.useTickets = false; ] { { } }, "context" : "envParam:entity", { return; ] "context" : "envParam:feedbackData", } return true; ] { var o = document.getElementById("custom_board_pagination_warning" + pagerId); "actions" : [ "action" : "rerender" "useSimpleView" : "false", "action" : "rerender" ] LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); }, LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); $(this).toggleClass("view-btn-open view-btn-close"); }, { ] "truncateBodyRetainsHtml" : "false", ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); } "action" : "rerender" { Erfahren Sie im nächsten Praxistipp, woran es liegen kann, wenn das Internet der Fritzbox sehr langsam ist. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); ] { "linkDisabled" : "false" ] } } "action" : "rerender" "actions" : [ "action" : "rerender" "event" : "editProductMessage", }, { "actions" : [ ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1950592,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "action" : "rerender" "displayStyle" : "horizontal", } }, ], { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'CJQH6EFIx4TNsOEBeldd4y6cf8SMtCv--wn3291Uc8g. "context" : "envParam:quiltName", }, "action" : "rerender" } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { } }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "editProductMessage", { "event" : "approveMessage", "kudosLinksDisabled" : "false", "actions" : [ "context" : "", watching = false; ] "context" : "", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { "event" : "unapproveMessage", } "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "event" : "MessagesWidgetEditAnswerForm", "useSubjectIcons" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); { "context" : "envParam:quiltName,message", "componentId" : "forums.widget.message-view", "action" : "rerender" "context" : "", ] ] ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "accessibility" : false, }, { { } LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", "event" : "removeThreadUserEmailSubscription", "event" : "editProductMessage", "action" : "rerender" } return false; "action" : "rerender" { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "action" : "rerender" "parameters" : { "actions" : [ "actions" : [ "event" : "MessagesWidgetCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); { "dialogKey" : "dialogKey" "action" : "rerender" "context" : "", }); "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" { "actions" : [ { window.location = "https://forum.vodafone.de/t5/Archiv-St%C3%B6rungsmeldungen/St%C3%A4ndige-Verbindungsabbr%C3%BCche-Fritzbox-6591/td-p/1950049" + "/page/" + val; ] } }, "actions" : [ "actions" : [ ] "context" : "envParam:quiltName", "action" : "rerender" ] if ( !watching ) { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "actions" : [ "truncateBody" : "true", } } } "actions" : [ "event" : "addThreadUserEmailSubscription", } }, "actions" : [ { "actions" : [ "action" : "rerender" } }, ], } "action" : "rerender" ], })(LITHIUM.jQuery); "actions" : [ "event" : "ProductAnswerComment", ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "linkDisabled" : "false" "includeRepliesModerationState" : "false", "kudosLinksDisabled" : "false", } }, if (isNaN(val) ) } } "action" : "pulsate" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); { "action" : "rerender" "actions" : [ "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", ] { } "event" : "unapproveMessage", LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); { "actions" : [ ] }); // console.log(key); "initiatorDataMatcher" : "data-lia-kudos-id" ] $(this).removeClass('active'); "event" : "MessagesWidgetCommentForm", "event" : "MessagesWidgetCommentForm", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); }, { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); } { }, }, "displayStyle" : "horizontal", "context" : "", } "revokeMode" : "true", if ( neededkeys[count] == key ) { ] "displayStyle" : "horizontal", function doChecks(pagerId, val) { { "showCountOnly" : "false", { "event" : "MessagesWidgetEditAction", } "context" : "envParam:selectedMessage", } return false; { { { }, } { "showCountOnly" : "false", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "context" : "envParam:selectedMessage", "event" : "expandMessage", Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. "parameters" : { count = 0; { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "addMessageUserEmailSubscription", setWarning(pagerId); "initiatorBinding" : true, ], } } "event" : "ProductMessageEdit", .attr('aria-expanded','false'); LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "actions" : [ "actions" : [ { "event" : "removeMessageUserEmailSubscription", // --> { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "deleteMessage", }); { "parameters" : { ] }, { "initiatorDataMatcher" : "data-lia-message-uid" } ] "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ], "actions" : [ "event" : "QuickReply", "useCountToKudo" : "false", "event" : "addThreadUserEmailSubscription", "kudosable" : "true", { { "event" : "markAsSpamWithoutRedirect", } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "removeThreadUserEmailSubscription", "action" : "rerender" } } "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetEditCommentForm", }, lithstudio: [], }, "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); var element = $(this).parent('li'); "actions" : [ "event" : "MessagesWidgetEditAction", "event" : "kudoEntity", { ] "actions" : [ } { "event" : "MessagesWidgetAnswerForm", })(LITHIUM.jQuery); "event" : "RevokeSolutionAction", window.location = "https://forum.vodafone.de/t5/Archiv-St%C3%B6rungsmeldungen/St%C3%A4ndige-Verbindungsabbr%C3%BCche-Fritzbox-6591/td-p/1950049" + "/page/" + val; }, "action" : "pulsate" "action" : "rerender" "disableLabelLinks" : "false", { } "actions" : [ } "context" : "envParam:quiltName,message", "event" : "approveMessage", "action" : "rerender" { { "initiatorBinding" : true, { "showCountOnly" : "false", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "AcceptSolutionAction", $(this).toggleClass("view-btn-open view-btn-close"); "context" : "envParam:selectedMessage", "actions" : [ ] "context" : "", { "event" : "editProductMessage", "initiatorDataMatcher" : "data-lia-message-uid" } return; LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, "context" : "", } { "context" : "", "revokeMode" : "true", { }, "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "useSubjectIcons" : "true", return false; "showCountOnly" : "false", }, function disableInput(pagerId) { $(document).ready(function(){ }, }, LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "revokeMode" : "true", "event" : "MessagesWidgetEditAction", "}); "action" : "rerender" "quiltName" : "ForumMessage", { } watching = false; "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1950444 .lia-rating-control-passive', '#form_4'); "context" : "", "event" : "editProductMessage", "context" : "", "event" : "kudoEntity", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1950592 .lia-rating-control-passive', '#form_5'); "useSimpleView" : "false", } else { { $(document).ready(function(){ setWarning(pagerId); { "parameters" : { ], "kudosable" : "true", "event" : "addThreadUserEmailSubscription", } { LITHIUM.Dialog({ "disableLinks" : "false", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950049}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1954132}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950099}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950104}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950392}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950444}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950592}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1950646}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1951271}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1951790}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1952229}}]); "actions" : [ }, { { }, }); "action" : "rerender" "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" }, "event" : "ProductAnswer", "initiatorBinding" : true, } "event" : "kudoEntity", } "actions" : [ "event" : "kudoEntity", } } "action" : "rerender" o.innerHTML = "Page must be an integer number. "actions" : [ "event" : "ProductAnswer", ] "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "context" : "", }, Bist du sicher, dass du fortfahren möchtest? LITHIUM.Dialog.options['773659222'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); "event" : "deleteMessage", ] { "selector" : "#messageview_7", "action" : "rerender" { "action" : "rerender" "action" : "rerender" ] { }); } { "actions" : [ { "context" : "envParam:feedbackData", ] "parameters" : { "action" : "addClassName" { { "action" : "rerender" "; "displaySubject" : "true", "action" : "rerender" "action" : "rerender" { "context" : "", ', 'ajax'); "event" : "markAsSpamWithoutRedirect", "useCountToKudo" : "false", }, { }, "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } o.innerHTML = ""; "context" : "", "action" : "rerender" { ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetMessageEdit", "selector" : "#kudosButtonV2_7", "kudosable" : "true", } "action" : "pulsate" watching = false; { "includeRepliesModerationState" : "false", "event" : "addMessageUserEmailSubscription", ] "action" : "rerender" "action" : "pulsate" "actions" : [ { "action" : "rerender" "action" : "rerender" { "action" : "rerender" { "context" : "envParam:quiltName", "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "action" : "rerender" "actions" : [ "context" : "", { "action" : "rerender" "actions" : [ ] ] ] ] "context" : "envParam:entity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/256654","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qrwWurReE44XywcllrTOxFZPeT2jQIWnUQ8Xw1AwTl0. "event" : "MessagesWidgetEditCommentForm", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "action" : "rerender" ], "initiatorDataMatcher" : "data-lia-message-uid" "event" : "unapproveMessage", }, { "componentId" : "kudos.widget.button", "event" : "markAsSpamWithoutRedirect", { Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Einschränkung beim Zugang zu Mein Vodafone App und Web, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. .attr('aria-expanded','true'); } }, }, } { ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/256654","ajaxErrorEventName":"LITHIUM:ajaxError","token":"reBUq7PuBDEJP1zn9gVu1m18jVbqmqHPEtBZkLjRNF4. } { ], "action" : "rerender" }, } "message" : "1950592", "action" : "pulsate" "context" : "envParam:quiltName", { ] ] ] "action" : "rerender" "event" : "RevokeSolutionAction", ] } "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ $(document).ready(function(){ "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "unapproveMessage", "event" : "ProductAnswerComment", "event" : "AcceptSolutionAction", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/256654","ajaxErrorEventName":"LITHIUM:ajaxError","token":"f9aJnY38OH0m0fWx0GW_xJxw-UKz3qjmr9zb8oeFzA4. { "actions" : [ "event" : "MessagesWidgetEditAction", "event" : "removeThreadUserEmailSubscription", "context" : "", "truncateBody" : "true", "useSimpleView" : "false", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "disableLabelLinks" : "false", Bist du sicher, dass du fortfahren möchtest? "disableLinks" : "false", "action" : "rerender" }, { "action" : "pulsate" ] "context" : "", ', 'ajax'); return false; "action" : "pulsate" // console.log('watching: ' + key); "componentId" : "forums.widget.message-view", "event" : "ProductAnswer", ] "event" : "kudoEntity", }, "actions" : [ "actions" : [ }, "context" : "", ', 'ajax'); } LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "removeMessageUserEmailSubscription", }, "event" : "QuickReply", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "revokeMode" : "true", }, }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",